DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax2 and Lcp65Ag2

DIOPT Version :9

Sequence 1:NP_001261467.1 Gene:Cpr65Ax2 / 59157 FlyBaseID:FBgn0042118 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_477272.1 Gene:Lcp65Ag2 / 38702 FlyBaseID:FBgn0020637 Length:105 Species:Drosophila melanogaster


Alignment Length:105 Identity:63/105 - (60%)
Similarity:77/105 - (73%) Gaps:3/105 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFAIVLFALFAVALAAPTVE---VLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAI 62
            |||.||..||||||||||..|   ::||:|:||.:::.|..|||||.:....|.|.:.|||.|||
  Fly     1 MKFLIVFVALFAVALAAPAAEEPTIVRSESDVGPESFKYDWETSDGQAAQAVGQLNDIGTENEAI 65

  Fly    63 STHGSFSYVGPDGQTYTVTYVADENGFQPQGAHLPVAPVA 102
            |..||:.::..|||||.|.|:||:||||||||||||||||
  Fly    66 SVSGSYRFIADDGQTYQVNYIADKNGFQPQGAHLPVAPVA 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax2NP_001261467.1 Chitin_bind_4 34..89 CDD:278791 27/54 (50%)
Lcp65Ag2NP_477272.1 Chitin_bind_4 37..92 CDD:306811 27/54 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466898
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 1 1.000 - - H43214
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27015
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 1 1.000 - - FOG0005922
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.