DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax2 and CG15754

DIOPT Version :10

Sequence 1:NP_652660.1 Gene:Cpr65Ax2 / 59157 FlyBaseID:FBgn0042118 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_572894.1 Gene:CG15754 / 32307 FlyBaseID:FBgn0030492 Length:281 Species:Drosophila melanogaster


Alignment Length:95 Identity:24/95 - (25%)
Similarity:31/95 - (32%) Gaps:25/95 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LAAPTVEVLRSDSNVGIDN---------YSYAVETSDGTSKSEEGVLKNAGTELEAISTHGSF-- 68
            ||...|:....|.|...||         |.:......|..:.|:|....        ..||..  
  Fly   170 LAGGQVDEELEDYNAWRDNFYELNEDGSYIFGYSIPHGIRRWEKGYYSE--------EQHGRVVE 226

  Fly    69 -SYVGP----DGQTYTV-TYVADENGFQPQ 92
             .||.|    .|..|.: .|.||..|:||:
  Fly   227 GFYVQPRHDSQGLRYELRCYRADSEGYQPR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax2NP_652660.1 Chitin_bind_4 34..89 CDD:459790 14/62 (23%)
CG15754NP_572894.1 None

Return to query results.
Submit another query.