DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax2 and Cpr65Av

DIOPT Version :9

Sequence 1:NP_001261467.1 Gene:Cpr65Ax2 / 59157 FlyBaseID:FBgn0042118 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_729146.1 Gene:Cpr65Av / 318014 FlyBaseID:FBgn0052405 Length:111 Species:Drosophila melanogaster


Alignment Length:100 Identity:54/100 - (54%)
Similarity:69/100 - (69%) Gaps:6/100 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AIVLFALFAVALAAPT-----VEVLRSDS-NVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAI 62
            ||..|||.:...|||.     ..:||.|: |:|.|.|::..|||||.::.|:..:|||||:.||:
  Fly    10 AICAFALLSTIRAAPLDDSQHATILRYDNDNIGTDGYNFGYETSDGVTRQEQAEVKNAGTDQEAL 74

  Fly    63 STHGSFSYVGPDGQTYTVTYVADENGFQPQGAHLP 97
            |..||.|:|.|||||||:.|:||||||||||.|||
  Fly    75 SVRGSVSWVAPDGQTYTLHYIADENGFQPQGDHLP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax2NP_001261467.1 Chitin_bind_4 34..89 CDD:278791 31/54 (57%)
Cpr65AvNP_729146.1 Chitin_bind_4 46..101 CDD:278791 31/54 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27015
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.