DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and Mrpl36

DIOPT Version :9

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_444393.1 Gene:Mrpl36 / 94066 MGIID:2137228 Length:102 Species:Mus musculus


Alignment Length:84 Identity:32/84 - (38%)
Similarity:45/84 - (53%) Gaps:14/84 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FHLLTRPAAPAIVSIQSSQLVAATTGICQTSGLLTPGSTLVQQVAGFKVKGRLKRRCKDCYIVVR 88
            |.|.|.|.|.....::|.        :|.     .|..||:..: |||.||.:|:||||||.|.|
Mouse    33 FLLGTLPRAKPCAEVRSV--------LCG-----RPLPTLLPSL-GFKTKGVIKKRCKDCYKVKR 83

  Fly    89 QERGYVICPTHPRHKQMSM 107
            :.|.:::|.|:|:|||..|
Mouse    84 RGRWFILCKTNPKHKQRQM 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..105 CDD:376334 19/34 (56%)
Mrpl36NP_444393.1 Ribosomal_L36 65..102 CDD:395356 20/36 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839883
Domainoid 1 1.000 52 1.000 Domainoid score I11461
eggNOG 1 0.900 - - E1_COG0257
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003238
OrthoInspector 1 1.000 - - oto94552
orthoMCL 1 0.900 - - OOG6_102773
Panther 1 1.100 - - LDO PTHR46909
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1263
SonicParanoid 1 1.000 - - X4252
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.