DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and UBA4

DIOPT Version :9

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_011979.1 Gene:UBA4 / 856511 SGDID:S000001153 Length:440 Species:Saccharomyces cerevisiae


Alignment Length:111 Identity:23/111 - (20%)
Similarity:35/111 - (31%) Gaps:38/111 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TRPAAPAIVSIQSSQLVAATTGICQTS----------GLLT-----PGSTLV-----QQVAGFKV 72
            |.|...|:.|.|...::....|:..|.          |:.|     |...|.     |.:..||:
Yeast   215 TPPPPNAVTSCQEGGVIGPCIGLVGTMMAVETLKLILGIYTNENFSPFLMLYSGFPQQSLRTFKM 279

  Fly    73 KGRLKRRCKDC-----------------YIVVRQERGYVICPTHPR 101
            :|| :.:|..|                 |.:....|.|.:|....|
Yeast   280 RGR-QEKCLCCGKNRTITKEAIEKGEINYELFCGARNYNVCEPDER 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..105 CDD:376334 11/49 (22%)
UBA4NP_011979.1 ThiF_MoeB_HesA_family 46..279 CDD:238386 13/63 (21%)
RHOD_ThiF 316..440 CDD:238784 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.