DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and RTC6

DIOPT Version :9

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_015141.1 Gene:RTC6 / 855918 SGDID:S000007224 Length:93 Species:Saccharomyces cerevisiae


Alignment Length:81 Identity:26/81 - (32%)
Similarity:42/81 - (51%) Gaps:17/81 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LTRP-AAPAIVSIQSSQ--LVAATTGICQTSGLLTPGSTLVQQVAGFKVKGRLKRRCKDCYIVVR 88
            :||. ..|:::|:.:.|  ||||...:...              .||||:..:|:.|.|||:|.|
Yeast    24 ITRACTVPSLLSVAAPQPALVAANRPLVFN--------------RGFKVRTSVKKFCSDCYLVRR 74

  Fly    89 QERGYVICPTHPRHKQ 104
            :.|.|:.|.::.:|||
Yeast    75 KGRVYIYCKSNKKHKQ 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..105 CDD:376334 16/35 (46%)
RTC6NP_015141.1 Ribosomal_L36 56..93 CDD:395356 16/35 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0257
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003238
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102773
Panther 1 1.100 - - LDO PTHR46909
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1263
SonicParanoid 1 1.000 - - X4252
TreeFam 1 0.960 - -
87.800

Return to query results.
Submit another query.