DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and rpl36

DIOPT Version :10

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_051092.1 Gene:rpl36 / 844725 -ID:- Length:37 Species:Arabidopsis thaliana


Alignment Length:34 Identity:13/34 - (38%)
Similarity:24/34 - (70%) Gaps:1/34 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 KVKGRLKRRCKDCYIVVRQERGYVICPTHPRHKQ 104
            |::..:::.|:.|.::.|:.|..||| ::|||||
plant     2 KIRASVRKICEKCRLIRRRGRIIVIC-SNPRHKQ 34

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..107 CDD:459811 13/34 (38%)
rpl36NP_051092.1 rpmJ 1..37 CDD:179039 13/34 (38%)

Return to query results.
Submit another query.