DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and AT5G20180

DIOPT Version :9

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001330928.1 Gene:AT5G20180 / 832141 AraportID:AT5G20180 Length:103 Species:Arabidopsis thaliana


Alignment Length:53 Identity:19/53 - (35%)
Similarity:31/53 - (58%) Gaps:4/53 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 KVKGRLKRRCKDCYIVVRQERGYVICPTHPRHKQMSMKKRDYKSWILTHATQS 123
            ||:..:|:.|:.|..|.|:.|.||||.::|:|||    ::.:.|:.....|.|
plant     2 KVRSSVKKMCEFCKTVKRRGRVYVICSSNPKHKQ----RQGFSSFAYEGITPS 50

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..105 CDD:376334 15/33 (45%)
AT5G20180NP_001330928.1 Ribosomal_L36 1..38 CDD:395356 16/39 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0257
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1640375at2759
OrthoFinder 1 1.000 - - FOG0003238
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102773
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.