powered by:
Protein Alignment mRpL36 and AT5G20180
DIOPT Version :9
Sequence 1: | NP_652658.1 |
Gene: | mRpL36 / 59151 |
FlyBaseID: | FBgn0042112 |
Length: | 128 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001330928.1 |
Gene: | AT5G20180 / 832141 |
AraportID: | AT5G20180 |
Length: | 103 |
Species: | Arabidopsis thaliana |
Alignment Length: | 53 |
Identity: | 19/53 - (35%) |
Similarity: | 31/53 - (58%) |
Gaps: | 4/53 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 KVKGRLKRRCKDCYIVVRQERGYVICPTHPRHKQMSMKKRDYKSWILTHATQS 123
||:..:|:.|:.|..|.|:.|.||||.::|:||| ::.:.|:.....|.|
plant 2 KVRSSVKKMCEFCKTVKRRGRVYVICSSNPKHKQ----RQGFSSFAYEGITPS 50
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0257 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1640375at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003238 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_102773 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.810 |
|
Return to query results.
Submit another query.