DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and Uba2

DIOPT Version :9

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_524756.2 Gene:Uba2 / 44496 FlyBaseID:FBgn0029113 Length:700 Species:Drosophila melanogaster


Alignment Length:46 Identity:12/46 - (26%)
Similarity:22/46 - (47%) Gaps:4/46 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 TSGLLTPGSTLVQQVAGFKVKGRLKRRCKDCYIVVR-QERGYVICP 97
            |:..:|.|.::::   .|||......:||..|..:| ..|.:.:.|
  Fly   403 TTNAITAGISVMR---AFKVLEAKWEQCKAVYARLRPNARNHFLVP 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..105 CDD:376334 9/29 (31%)
Uba2NP_524756.2 ThiF 7..>177 CDD:279270
Uba2_SUMO 21..459 CDD:238766 12/46 (26%)
UAE_UbL 467..552 CDD:291402
UBA2_C 573..691 CDD:292812
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.