powered by:
Protein Alignment mRpL36 and uba3
DIOPT Version :9
Sequence 1: | NP_652658.1 |
Gene: | mRpL36 / 59151 |
FlyBaseID: | FBgn0042112 |
Length: | 128 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_998632.1 |
Gene: | uba3 / 406776 |
ZFINID: | ZDB-GENE-040426-2825 |
Length: | 462 |
Species: | Danio rerio |
Alignment Length: | 62 |
Identity: | 15/62 - (24%) |
Similarity: | 26/62 - (41%) |
Gaps: | 15/62 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 GLLTPGSTLVQQV----AGFKVKGRL----KRRCKDCYI-VVRQERGYVIC-----PTHPRH 102
|:|.| |:::..: .|||...|: ...|.||.: :...:..:.:| |..|.|
Zfish 187 GVLDP-SSIIPLIDGGTEGFKGNARVILPGMTACIDCTLELYPPQINFPMCTIASMPRLPEH 247
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0476 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.