DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment mRpL36 and uba3

DIOPT Version :9

Sequence 1:	NP_652658.1	Gene:	mRpL36 / 59151	FlyBaseID:	FBgn0042112	Length:	128	Species:	Drosophila melanogaster
Sequence 2:	NP_998632.1	Gene:	uba3 / 406776	ZFINID:	ZDB-GENE-040426-2825	Length:	462	Species:	Danio rerio

Alignment Length:	62	Identity:	15/62 - (24%)
Similarity:	26/62 - (41%)	Gaps:	15/62 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly    55 GLLTPGSTLVQQV----AGFKVKGRL----KRRCKDCYI-VVRQERGYVIC-----PTHPRH 102
            |:|.| |:::..:    .|||...|:    ...|.||.: :...:..:.:|     |..|.|
Zfish   187 GVLDP-SSIIPLIDGGTEGFKGNARVILPGMTACIDCTLELYPPQINFPMCTIASMPRLPEH 247

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
mRpL36	NP_652658.1	Ribosomal_L36	70..105	CDD:376334	10/43 (23%)
uba3	NP_998632.1	Interaction with ube2m N-terminus. /evidence=ECO:0000250	52..69
		ThiF	66..>240	CDD:279270	12/53 (23%)
		Uba3_RUB	70..367	CDD:238765	15/62 (24%)
		Interaction with ube2m N-terminus. /evidence=ECO:0000250	156..160
		Interaction with ube2m N-terminus. /evidence=ECO:0000250	191..216		6/25 (24%)
		Interaction with nedd8. /evidence=ECO:0000250	226..228		0/1 (0%)
		Interaction with nae1. /evidence=ECO:0000250	241..247		2/5 (40%)
		Interaction with nae1. /evidence=ECO:0000250	291..294
		Interaction with ube2m N-terminus. /evidence=ECO:0000250	330..337
		Interaction with nedd8. /evidence=ECO:0000250	351..356
		Interaction with ube2m core domain. /evidence=ECO:0000250	367..462
		E2_bind	375..460	CDD:285976
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0476
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900