DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and APP-BP1

DIOPT Version :9

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001261699.1 Gene:APP-BP1 / 39244 FlyBaseID:FBgn0261112 Length:524 Species:Drosophila melanogaster


Alignment Length:61 Identity:19/61 - (31%)
Similarity:24/61 - (39%) Gaps:20/61 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RLWNGLSAARGFHLLTRPAAPAIVSIQSSQLVAATTGICQTS-GLLTPGSTLVQQVAGFKV 72
            |||       |.|..|...|..:.      ||..|...|:|: ||:.||      :.||.|
  Fly    23 RLW-------GEHGQTLLEAATVC------LVNVTAVGCETAKGLVLPG------IGGFTV 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..105 CDD:376334 2/3 (67%)
APP-BP1NP_001261699.1 APPBP1_RUB 16..522 CDD:238770 19/61 (31%)
ThiF 17..>171 CDD:223552 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.