DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and Mrpl36

DIOPT Version :9

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001102349.1 Gene:Mrpl36 / 364656 RGDID:1306375 Length:97 Species:Rattus norvegicus


Alignment Length:89 Identity:34/89 - (38%)
Similarity:48/89 - (53%) Gaps:18/89 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RGFHLL--TRPAAPAIVSIQSSQLVAATTGICQTSGLLTPGSTL-VQQVAGFKVKGRLKRRCKDC 83
            |.|.:|  |.|:|.....::|               ||..|..| :|...|||.||.:|:||:||
  Rat    24 RAFSILLGTLPSAKPCAEVRS---------------LLCGGPVLSLQPSLGFKTKGVIKKRCRDC 73

  Fly    84 YIVVRQERGYVICPTHPRHKQMSM 107
            |:|.|:.|.:|:|.|:|:|||..|
  Rat    74 YMVKRRGRWFVLCKTNPKHKQRQM 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..105 CDD:376334 19/34 (56%)
Mrpl36NP_001102349.1 Ribosomal_L36 60..97 CDD:278851 20/36 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343724
Domainoid 1 1.000 53 1.000 Domainoid score I11082
eggNOG 1 0.900 - - E1_COG0257
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1640375at2759
OrthoFinder 1 1.000 - - FOG0003238
OrthoInspector 1 1.000 - - oto98064
orthoMCL 1 0.900 - - OOG6_102773
Panther 1 1.100 - - LDO PTHR46909
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4252
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.710

Return to query results.
Submit another query.