DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and Mocs3

DIOPT Version :9

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001101274.1 Gene:Mocs3 / 311655 RGDID:1307044 Length:458 Species:Rattus norvegicus


Alignment Length:98 Identity:23/98 - (23%)
Similarity:40/98 - (40%) Gaps:21/98 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PAIVS-IQSSQLVAATTGICQTSGLLTPGSTLV-QQVAGFKVKGRLKRRCKDCYIVVRQE----- 90
            |.::. :|:.:::....|:    |....||.|: ..:.|...:.||:||..||.:..:|.     
  Rat   247 PGVLGCVQALEVLKIAAGL----GTTYSGSMLLFDGLGGHFRRIRLRRRRPDCVVCGQQPTVTCL 307

  Fly    91 RGY-VICPTHPRHKQMSMK---------KRDYK 113
            :.| ..|.:....|..|:|         ..|||
  Rat   308 KNYEAFCGSSATDKCRSLKLLSPEERISVTDYK 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..105 CDD:376334 10/40 (25%)
Mocs3NP_001101274.1 PRK07411 53..458 CDD:180967 23/98 (23%)
ThiF_MoeB_HesA_family 60..283 CDD:238386 8/39 (21%)
RHOD_ThiF 325..458 CDD:238784 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.