DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and Sae1

DIOPT Version :9

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001012063.1 Gene:Sae1 / 308384 RGDID:1306098 Length:349 Species:Rattus norvegicus


Alignment Length:58 Identity:13/58 - (22%)
Similarity:26/58 - (44%) Gaps:6/58 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SQLVAATTGICQTSGLLTP-GSTLVQQVAGFKVKGRLKRRCKDCYIV-----VRQERG 92
            ::|.::.|.:.:...|..| ...|....:|.|.:..|||...|.:::     .|.::|
  Rat   200 AKLDSSETTMVKKKVLFCPVKEALAVDWSGEKAQAALKRTAPDYFLLQVLLKFRTDKG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..105 CDD:376334 7/28 (25%)
Sae1NP_001012063.1 Aos1_SUMO 19..344 CDD:238769 13/58 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.