DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and Uba5

DIOPT Version :9

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001009669.1 Gene:Uba5 / 300968 RGDID:1311702 Length:403 Species:Rattus norvegicus


Alignment Length:46 Identity:14/46 - (30%)
Similarity:19/46 - (41%) Gaps:3/46 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AAPAIVSIQSSQLVAATTGICQTSGLLTPG---STLVQQVAGFKVK 73
            |.|.:|:....:......|:|..|...|.|   ..|||.|..|.:|
  Rat   228 APPLVVASNIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLK 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..105 CDD:376334 2/4 (50%)
Uba5NP_001009669.1 ThiF_MoeB_HesA_family 50..293 CDD:238386 14/46 (30%)
ThiF 51..307 CDD:279270 14/46 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..337
UFM1-interacting sequence (UIS). /evidence=ECO:0000250|UniProtKB:Q9GZZ9 333..345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.