Sequence 1: | NP_652658.1 | Gene: | mRpL36 / 59151 | FlyBaseID: | FBgn0042112 | Length: | 128 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001022680.1 | Gene: | mrpl-36 / 259526 | WormBaseID: | WBGene00010783 | Length: | 77 | Species: | Caenorhabditis elegans |
Alignment Length: | 48 | Identity: | 23/48 - (47%) |
---|---|---|---|
Similarity: | 31/48 - (64%) | Gaps: | 0/48 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 LLTPGSTLVQQVAGFKVKGRLKRRCKDCYIVVRQERGYVICPTHPRHK 103 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mRpL36 | NP_652658.1 | Ribosomal_L36 | 70..105 | CDD:376334 | 18/34 (53%) |
mrpl-36 | NP_001022680.1 | Ribosomal_L36 | 33..68 | CDD:278851 | 18/34 (53%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160161249 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0257 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1640375at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0003238 | |
OrthoInspector | 1 | 1.000 | - | - | oto20621 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_102773 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR46909 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1263 |
SonicParanoid | 1 | 1.000 | - | - | X4252 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
12 | 11.740 |