DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and mrpl-36

DIOPT Version :9

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_001022680.1 Gene:mrpl-36 / 259526 WormBaseID:WBGene00010783 Length:77 Species:Caenorhabditis elegans


Alignment Length:48 Identity:23/48 - (47%)
Similarity:31/48 - (64%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LLTPGSTLVQQVAGFKVKGRLKRRCKDCYIVVRQERGYVICPTHPRHK 103
            ||...:.:.|:.||||||.|||.||:.||.:..:.|.:|.|..:||||
 Worm    19 LLAVRNPMCQETAGFKVKSRLKLRCRSCYFLRVEGRLHVECNENPRHK 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..105 CDD:376334 18/34 (53%)
mrpl-36NP_001022680.1 Ribosomal_L36 33..68 CDD:278851 18/34 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161249
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0257
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1640375at2759
OrthoFinder 1 1.000 - - FOG0003238
OrthoInspector 1 1.000 - - oto20621
orthoMCL 1 0.900 - - OOG6_102773
Panther 1 1.100 - - LDO PTHR46909
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1263
SonicParanoid 1 1.000 - - X4252
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.