DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and SPBC83.06c

DIOPT Version :9

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_595638.2 Gene:SPBC83.06c / 2540781 PomBaseID:SPBC83.06c Length:92 Species:Schizosaccharomyces pombe


Alignment Length:65 Identity:27/65 - (41%)
Similarity:36/65 - (55%) Gaps:7/65 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ATTGICQTSGL-LTPGSTLVQQV------AGFKVKGRLKRRCKDCYIVVRQERGYVICPTHPRHK 103
            |..|:.:.:.: |||...|...:      .|||||..:|:||..||.|.|:.|.||:|..|||||
pombe    24 AQKGLLKNASMFLTPAFRLSPSLLPWNFSRGFKVKASVKKRCSSCYFVRRKGRLYVLCKKHPRHK 88

  Fly   104  103
            pombe    89  88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..105 CDD:376334 20/34 (59%)
SPBC83.06cNP_595638.2 Ribosomal_L36 55..92 CDD:278851 20/34 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 49 1.000 Domainoid score I3434
eggNOG 1 0.900 - - E1_COG0257
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003238
OrthoInspector 1 1.000 - - oto101769
orthoMCL 1 0.900 - - OOG6_102773
Panther 1 1.100 - - LDO PTHR46909
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1263
SonicParanoid 1 1.000 - - X4252
TreeFam 1 0.960 - -
109.800

Return to query results.
Submit another query.