DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and Nae1

DIOPT Version :9

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_659180.1 Gene:Nae1 / 234664 MGIID:2384561 Length:534 Species:Mus musculus


Alignment Length:138 Identity:24/138 - (17%)
Similarity:42/138 - (30%) Gaps:76/138 - (55%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LASRILQQGSRLWNGLSAARGFHLLTRPAAPAIVSIQSSQLVAATTGICQTSGLLTPGSTLVQQV 67
            |.|.:|:....|||                        ||:...   ||:|.||:          
Mouse   132 LESTLLRLADVLWN------------------------SQIPLL---ICRTYGLV---------- 159

  Fly    68 AGFKVKGRLKRRCKDCYIVVRQERGYVICPTHP-----------------RHKQM----SMKKRD 111
                  |.::       |::::   :.:..:||                 .|.|.    .|:|:|
Mouse   160 ------GYMR-------IIIKE---HPVIESHPDNALEDLRLDKPFPELREHLQSYDLDHMEKKD 208

  Fly   112 YK--SWIL 117
            :.  .||:
Mouse   209 HSHTPWIV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..105 CDD:376334 5/51 (10%)
Nae1NP_659180.1 ThiF 9..>193 CDD:223552 17/113 (15%)
APPBP1_RUB 11..532 CDD:238770 24/138 (17%)
Interaction with UBA3. /evidence=ECO:0000250 331..344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.