DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and atg-7

DIOPT Version :9

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_502064.1 Gene:atg-7 / 178005 WormBaseID:WBGene00010882 Length:647 Species:Caenorhabditis elegans


Alignment Length:83 Identity:20/83 - (24%)
Similarity:27/83 - (32%) Gaps:20/83 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AAPAIVSIQSSQLVAATTGICQ-TSGLLTPGS----TLVQQVAGFKVKGRLKR------------ 78
            |.|....|.|...|...:.:.| ...|.||.|    |.|...|..:::|.|.|            
 Worm   526 ARPGTSMIASGIAVELLSSVLQYPDPLKTPASHDDNTTVLGAAPHQIRGFLGRFQQILPSVKRFD 590

  Fly    79 ---RCKDCYIVVRQERGY 93
               .|.|......|:.|:
 Worm   591 QCVACGDAIAAQFQQNGW 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..105 CDD:376334 7/39 (18%)
atg-7NP_502064.1 E1_like_apg7 4..635 CDD:273590 20/83 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.