DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and moc-3

DIOPT Version :9

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:NP_501359.1 Gene:moc-3 / 177607 WormBaseID:WBGene00018357 Length:402 Species:Caenorhabditis elegans


Alignment Length:40 Identity:12/40 - (30%)
Similarity:16/40 - (40%) Gaps:17/40 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 YVICPTHP-----------RHKQMSMKKRD----YKSWIL 117
            :|||  |.           |.|.:.:|.||    |:.|.|
 Worm   356 FVIC--HRGNDSQRAVLLLREKLVDIKFRDIIGGYEQWAL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..105 CDD:376334 6/22 (27%)
moc-3NP_501359.1 PRK07878 8..402 CDD:181156 12/40 (30%)
ThiF_MoeB_HesA_family 17..246 CDD:238386
RHOD_ThiF 283..402 CDD:238784 12/40 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0476
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.