DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL36 and ykgO

DIOPT Version :10

Sequence 1:NP_652658.1 Gene:mRpL36 / 59151 FlyBaseID:FBgn0042112 Length:128 Species:Drosophila melanogaster
Sequence 2:YP_588437.1 Gene:ykgO / 1450238 ECOCYCID:G0-10434 Length:46 Species:Escherichia coli


Alignment Length:34 Identity:16/34 - (47%)
Similarity:22/34 - (64%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KRRCKDCYIVVRQERGYVICPTHPRHKQMSMKKR 110
            |.|..||.||.|:.|.||||.::||.|.:..:|:
E. coli    11 KERHPDCQIVKRKGRLYVICKSNPRFKAVQGRKK 44

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL36NP_652658.1 Ribosomal_L36 70..107 CDD:459811 15/29 (52%)
ykgOYP_588437.1 rpmJ 1..41 CDD:179138 15/29 (52%)

Return to query results.
Submit another query.