DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18766 and AT5G47660

DIOPT Version :10

Sequence 1:NP_652657.1 Gene:CG18766 / 59150 FlyBaseID:FBgn0042111 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_199577.1 Gene:AT5G47660 / 834817 AraportID:AT5G47660 Length:398 Species:Arabidopsis thaliana


Alignment Length:61 Identity:17/61 - (27%)
Similarity:30/61 - (49%) Gaps:9/61 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 DYDKFVDIVKNIVDTHK-STPDKVDTFGD-FIKSYMKRWPERLQDEAINHITNYVIVKNME 292
            |.|...|:.|.:....| .|..|::.|.: .:.|.||| .|::.::.||      :::.||
plant   155 DSDSSPDVRKTVTGKRKRETRVKLEHFLEKLVGSMMKR-QEKMHNQLIN------VMEKME 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18766NP_652657.1 Myb_DNA-bind_4 10..93 CDD:463994
AT5G47660NP_199577.1 GT1 302..365 CDD:213402
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.