DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18766 and msantd1

DIOPT Version :9

Sequence 1:NP_001263007.1 Gene:CG18766 / 59150 FlyBaseID:FBgn0042111 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001314777.1 Gene:msantd1 / 798497 ZFINID:ZDB-GENE-121227-1 Length:274 Species:Danio rerio


Alignment Length:171 Identity:41/171 - (23%)
Similarity:77/171 - (45%) Gaps:26/171 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NKKRRQWEDSGVLELIKLWKVCAYELRTIKRNGHLYVAMAKQLTSL-GVPVTALEVHFKVNNLTQ 70
            :::.|.|.||.:..|:.:|:....||:..|||..:|..|||||..| |......|:..|:.|:|.
Zfish    19 HRRARNWTDSEMKALVYIWEEYVTELKKAKRNAKIYETMAKQLYELTGEQRHREEIKMKITNMTF 83

  Fly    71 RYRQEQKTFETTGIISTWKFYSQVDDVFKSLAAHTGYKDKRMTSASNTSSLPSTSES-------- 127
            ::|:.:.|.........|.:|..::.:...:..| |:    |:..:.:||.||||:.        
Zfish    84 QFRKLKYTANGGSSTPDWPYYKSIERILSKVPDH-GH----MSPPNLSSSGPSTSQHDPAVPQSA 143

  Fly   128 ------PVWKNPMSQQEFN------SNNTEGFYKTEYGMHR 156
                  |.:.....:::.|      ::|:...::|....|:
Zfish   144 PPSGFLPEYTGSSEERDMNDEDDGLTDNSASSFETRSQPHK 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18766NP_001263007.1 Myb_DNA-bind_4 10..93 CDD:404682 27/83 (33%)
msantd1NP_001314777.1 Myb_DNA-bind_4 22..105 CDD:290549 26/82 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592288
Domainoid 1 1.000 52 1.000 Domainoid score I11532
eggNOG 1 0.900 - - E1_KOG4282
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008224
OrthoInspector 1 1.000 - - oto40827
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22666
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5282
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.