DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18766 and Msantd1

DIOPT Version :9

Sequence 1:NP_001263007.1 Gene:CG18766 / 59150 FlyBaseID:FBgn0042111 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001102559.1 Gene:Msantd1 / 498394 RGDID:1565796 Length:278 Species:Rattus norvegicus


Alignment Length:157 Identity:36/157 - (22%)
Similarity:72/157 - (45%) Gaps:13/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PYEKFNKKRRQWEDSGVLELIKLWKVCAYELRTIKRNGHLYVAMAKQLTSL-GVPVTALEVHFKV 65
            |..:.:::.|.|.|:.:..|:.:|:....||:..|||..:|..||.:|..: |......|:..|:
  Rat    35 PQTEKHRRARNWTDAEMRGLMLVWEEFFDELKQTKRNAKVYEKMASKLFEMTGERRLGEEIKIKI 99

  Fly    66 NNLTQRYRQEQKTFETTGIISTWKFYSQVDDVFKSLAAH------TGYKDKRMTSASNTSSLPST 124
            .|:|.:||:.:...::..:...|.:|..:|.:...:...      .|.:....||.:..|..||.
  Rat   100 TNMTFQYRKLKCMTDSESVPPDWPYYLAIDRILAKVPESCEGKLPDGQQPGPSTSQTEASLSPSA 164

  Fly   125 SESPVWKNPMSQQEFNSNNTEGFYKTE 151
            ..:|::. |.:|..:     ||.::.:
  Rat   165 KSTPLYL-PYTQCSY-----EGRFEDD 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18766NP_001263007.1 Myb_DNA-bind_4 10..93 CDD:404682 23/83 (28%)
Msantd1NP_001102559.1 Myb_DNA-bind_4 43..125 CDD:290549 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350582
Domainoid 1 1.000 46 1.000 Domainoid score I11834
eggNOG 1 0.900 - - E1_KOG4282
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008224
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22666
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.