DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18766 and Msantd1

DIOPT Version :9

Sequence 1:NP_001263007.1 Gene:CG18766 / 59150 FlyBaseID:FBgn0042111 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_997160.1 Gene:Msantd1 / 403174 MGIID:2684990 Length:278 Species:Mus musculus


Alignment Length:157 Identity:37/157 - (23%)
Similarity:72/157 - (45%) Gaps:13/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PYEKFNKKRRQWEDSGVLELIKLWKVCAYELRTIKRNGHLYVAMAKQLTSL-GVPVTALEVHFKV 65
            |..:.:::.|.|.|:.:..|:.:|:....||:..|||..:|..||.:|..: |......|:..|:
Mouse    35 PQTEKHRRARNWTDAEMRGLMLVWEEFFDELKQTKRNAKVYEKMASKLFEMTGERRLGEEIKIKI 99

  Fly    66 NNLTQRYRQEQKTFETTGIISTWKFYSQVDDVFKSLAAH------TGYKDKRMTSASNTSSLPST 124
            .|:|.:||:.:...::..|...|.:|..:|.:...:...      .|.:....||.:..|..||.
Mouse   100 TNMTFQYRKLKCMTDSESIPPDWPYYLAIDRILAKVPESCEGKLPDGQQPGPSTSQTEASLSPSA 164

  Fly   125 SESPVWKNPMSQQEFNSNNTEGFYKTE 151
            ..:|::. |.:|..:     ||.::.:
Mouse   165 KSTPLYL-PYTQCSY-----EGHFEDD 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18766NP_001263007.1 Myb_DNA-bind_4 10..93 CDD:404682 24/83 (29%)
Msantd1NP_997160.1 Myb_DNA-bind_4 43..125 CDD:290549 23/81 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..167 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847077
Domainoid 1 1.000 46 1.000 Domainoid score I12097
eggNOG 1 0.900 - - E1_KOG4282
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008224
OrthoInspector 1 1.000 - - oto92804
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22666
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5282
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.