DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18766 and ssp

DIOPT Version :9

Sequence 1:NP_001263007.1 Gene:CG18766 / 59150 FlyBaseID:FBgn0042111 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_648546.1 Gene:ssp / 39375 FlyBaseID:FBgn0036248 Length:368 Species:Drosophila melanogaster


Alignment Length:205 Identity:46/205 - (22%)
Similarity:87/205 - (42%) Gaps:35/205 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QWEDSGVLELIKLWKVCAYELRTIKRNGHLYVAMAKQLTSLGVPVTALEVHFKVNNLTQRYRQEQ 76
            :|....|..|::||.....:||..::...:...|..::.|||...|  |:..|::::.|:||:|.
  Fly   120 EWSFHAVELLLELWARHCVDLRDSRKRVQVIWKMTGEMKSLGFTFT--EIKNKIDDMGQQYRRES 182

  Fly    77 KTFETTGIISTWKFYSQVDDVFKSLAAHTGYKDKRMT---------SASNT----SSLPSTSESP 128
            ...:|||..|.|:::..:..:|.|        |:.:.         ||.||    :|..|..:.|
  Fly   183 HMEKTTGHKSQWEYFETMKMIFSS--------DRNIIDNMPLDKSGSAPNTTSEHNSFGSQLDEP 239

  Fly   129 -VWKNPMSQQEFNSNNTEGFYKTEYGMHRHFMDHSQPPPNAGSV--DNFMASSAAVAAVAAAASA 190
             :.:|.:..|:.:....:.|...||.      |.:|...:...:  ||.:..   :...:...|.
  Fly   240 LIDRNYLRSQKVHPGEGDSFDMNEYA------DEAQEDVDELRILKDNIIRE---IEESSTVHSQ 295

  Fly   191 RLADNNMDQQ 200
            ...::.:|||
  Fly   296 ENYEDELDQQ 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18766NP_001263007.1 Myb_DNA-bind_4 10..93 CDD:404682 23/80 (29%)
sspNP_648546.1 Myb_DNA-bind_4 120..198 CDD:290549 23/79 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464314
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22666
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.