DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18766 and CG10494

DIOPT Version :9

Sequence 1:NP_001263007.1 Gene:CG18766 / 59150 FlyBaseID:FBgn0042111 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_726079.1 Gene:CG10494 / 37453 FlyBaseID:FBgn0034634 Length:523 Species:Drosophila melanogaster


Alignment Length:292 Identity:57/292 - (19%)
Similarity:108/292 - (36%) Gaps:81/292 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RRQWEDSGV---LELIKLWKVCAYELRTIKRNGHLYVAMAKQLTSLGVPVTALEVHFKVNNLTQR 71
            |.:|.:..|   |:||....:.|..|:  |||..::..::|::........|.::..|...|.:.
  Fly   178 RCKWAEGEVDLLLDLIHTLGLRAALLQ--KRNAKVFKLLSKEMAKRNCHKGAEKLRIKFQQLRRL 240

  Fly    72 YRQEQ----KTFETTGIISTWKFYSQVDDVFKSLAAHTGYKDKRMTSASNTSSLPSTSESPVWKN 132
            |.:.:    ||||      .::....|.|..:..||.....:..::|||::              
  Fly   241 YNKVKNGTGKTFE------HFEAMRLVLDPTEEEAAADAEAEAHLSSASDS-------------- 285

  Fly   133 PMSQQEFN-SNNTEGFYKTEYGMHRHFMDHSQPPPNAGSVDNFMASSAAVAAVAAAASARLADNN 196
                 :|| |:..||......|.| .:.|.        .||:|:..              :.||.
  Fly   286 -----DFNDSDEEEGDASQRSGAH-FWTDE--------EVDSFLLI--------------IRDNG 322

  Fly   197 MDQQMNTAAGGSGGSGGGGGNTNGGVANY---QKIKKS-HEDYDKFVDIVK-------NIVDTHK 250
            ..:.::       ||......|...::|.   |.||:: |:..:|...:.|       :.:|..:
  Fly   323 FFRALD-------GSRKRNFQTLVHISNILAKQDIKRTPHQLRNKLRLLCKRHREAKEHGLDNVR 380

  Fly   251 STPDKVDTFGDFIKSYMKRWPERLQDEAINHI 282
            ..|...:.|.:.|::     |...::.||:.:
  Fly   381 ILPRHFELFDELIQA-----PRENRESAISRL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18766NP_001263007.1 Myb_DNA-bind_4 10..93 CDD:404682 20/89 (22%)
CG10494NP_726079.1 Myb_DNA-bind_4 44..123 CDD:290549
Myb_DNA-bind_4 178..257 CDD:290549 20/86 (23%)
Myb_DNA-bind_4 303..391 CDD:290549 20/117 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4282
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.