DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18766 and CG13148

DIOPT Version :9

Sequence 1:NP_001263007.1 Gene:CG18766 / 59150 FlyBaseID:FBgn0042111 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001260923.1 Gene:CG13148 / 36398 FlyBaseID:FBgn0033767 Length:370 Species:Drosophila melanogaster


Alignment Length:328 Identity:65/328 - (19%)
Similarity:100/328 - (30%) Gaps:111/328 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PYEKFNKKRRQWEDSGVLELI------------------KLWKVCAYELRTIKRNGHLYVAMAKQ 48
            |||      |.|.......||                  .||..|                 .:|
  Fly    58 PYE------RAWTTEATRALIHIRGPMEGSFTEGRQKRTALWLHC-----------------TRQ 99

  Fly    49 LTSLGVPVTALEVHFKVNNLTQRYRQEQKTFETTGIISTWKFYSQVDDVFKSLAAHTGYK-DKRM 112
            |..||...:|.:|..|.:|:...|.:.......:|.:. |:|:   :::||.|   .|.| |..|
  Fly   100 LQRLGFRYSAAKVQKKWHNILITYNKNLNKKYVSGYVH-WEFF---EEMFKYL---QGKKADFDM 157

  Fly   113 TSASNTSSLPSTSESPVWKNP---MSQQEFNSNNTEGFYKTEYGMHRHFMDHSQPPPNAGSVDNF 174
            .....||:.|....|...:||   :.||......|....|......:     .|.||...:.|  
  Fly   158 QLPQQTSNAPQAPHSANGQNPNPGIPQQPLQLQPTPVSLKPGTPQMQ-----VQLPPQTAAKD-- 215

  Fly   175 MASSAAVAAVAAAASARLADNNMDQQMNTAAGGSGGSGGGGGNTNGGVANYQKIKKSHEDYDKFV 239
              |...:..|....        :..|||..:                        ||::::|:..
  Fly   216 --SQPYITPVDQVL--------LQAQMNLDS------------------------KSNDEFDEDS 246

  Fly   240 DIVKNIVDTHKSTPDKVDTFGDFIKSYMKRWPERLQDEAINHITN---YVIVKNMEHSMVSSHNP 301
            :.:..:|...|...|     ||.:..     .||..|.:.:...|   |.:.:.|     .||..
  Fly   247 NSMSEVVRQPKMEYD-----GDQVAE-----AERTNDSSQHLEVNGKLYDLARPM-----GSHQA 296

  Fly   302 EGV 304
            .|:
  Fly   297 SGI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18766NP_001263007.1 Myb_DNA-bind_4 10..93 CDD:404682 19/100 (19%)
CG13148NP_001260923.1 Myb_DNA-bind_4 60..143 CDD:290549 20/109 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4282
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.