DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18766 and MSANTD1

DIOPT Version :9

Sequence 1:NP_001263007.1 Gene:CG18766 / 59150 FlyBaseID:FBgn0042111 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001036155.1 Gene:MSANTD1 / 345222 HGNCID:33741 Length:278 Species:Homo sapiens


Alignment Length:156 Identity:38/156 - (24%)
Similarity:72/156 - (46%) Gaps:11/156 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PYEKFNKKRRQWEDSGVLELIKLWKVCAYELRTIKRNGHLYVAMAKQLTSL-GVPVTALEVHFKV 65
            |..:.:::.|.|.|:.:..|:.:|:....||:..|||..:|..||.:|..: |......|:..|:
Human    35 PQAEKHRRARNWTDAEMRGLMLVWEEFFDELKQTKRNAKVYEKMASKLFEMTGERRLGEEIKIKI 99

  Fly    66 NNLTQRYRQEQKTFETTGIISTWKFYSQVDDVFKSLAAHTGYKDKRMTSASNTSSLPSTSE---- 126
            .|:|.:||:.:...::......|.:|..:|.:   ||......|.::..:....  ||||:    
Human   100 TNMTFQYRKLKCMTDSESAPPDWPYYLAIDGI---LAKVPESCDGKLPDSQPPG--PSTSQTEAS 159

  Fly   127 -SPVWKNPMSQQEFNSNNTEGFYKTE 151
             ||..|:......:|..:.||.::.:
Human   160 LSPPAKSTPLYFPYNQCSYEGRFEDD 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18766NP_001263007.1 Myb_DNA-bind_4 10..93 CDD:404682 23/83 (28%)
MSANTD1NP_001036155.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Myb_DNA-bind_4 44..125 CDD:316362 22/80 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..168 8/31 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156667
Domainoid 1 1.000 44 1.000 Domainoid score I12323
eggNOG 1 0.900 - - E1_KOG4282
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008224
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22666
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5282
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.