Sequence 1: | NP_001263007.1 | Gene: | CG18766 / 59150 | FlyBaseID: | FBgn0042111 | Length: | 308 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001036155.1 | Gene: | MSANTD1 / 345222 | HGNCID: | 33741 | Length: | 278 | Species: | Homo sapiens |
Alignment Length: | 156 | Identity: | 38/156 - (24%) |
---|---|---|---|
Similarity: | 72/156 - (46%) | Gaps: | 11/156 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 PYEKFNKKRRQWEDSGVLELIKLWKVCAYELRTIKRNGHLYVAMAKQLTSL-GVPVTALEVHFKV 65
Fly 66 NNLTQRYRQEQKTFETTGIISTWKFYSQVDDVFKSLAAHTGYKDKRMTSASNTSSLPSTSE---- 126
Fly 127 -SPVWKNPMSQQEFNSNNTEGFYKTE 151 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18766 | NP_001263007.1 | Myb_DNA-bind_4 | 10..93 | CDD:404682 | 23/83 (28%) |
MSANTD1 | NP_001036155.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..27 | ||
Myb_DNA-bind_4 | 44..125 | CDD:316362 | 22/80 (28%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 138..168 | 8/31 (26%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165156667 | |
Domainoid | 1 | 1.000 | 44 | 1.000 | Domainoid score | I12323 |
eggNOG | 1 | 0.900 | - | - | E1_KOG4282 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0008224 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22666 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5282 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.870 |