DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18766 and Utf1

DIOPT Version :9

Sequence 1:NP_001263007.1 Gene:CG18766 / 59150 FlyBaseID:FBgn0042111 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_033508.1 Gene:Utf1 / 22286 MGIID:1276125 Length:339 Species:Mus musculus


Alignment Length:110 Identity:27/110 - (24%)
Similarity:35/110 - (31%) Gaps:47/110 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 KSLAAHTGYKDKRMTSA---SNTSSLPSTSESPVWKNPMSQQEFNSNNTEGFYKTEYGMHRHFMD 160
            ||..||      |:||:   ::|.:||          |.....|.|:.|.            ..|
Mouse   210 KSAGAH------RITSSPPLTSTDTLP----------PEPGHTFESSPTP------------TPD 246

  Fly   161 HSQPPPN-AGSVDNFMASSAAVAAVAAAASARLADNNMDQQMNTA 204
            |....|| ...:....|||..||               .|.:|||
Mouse   247 HDVETPNEPPGLSQGRASSPQVA---------------PQSLNTA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18766NP_001263007.1 Myb_DNA-bind_4 10..93 CDD:404682
Utf1NP_033508.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62
Myb_DNA-bind_4 79..>126 CDD:290549
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..270 23/102 (23%)
Leucine-zipper 279..310
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4282
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.