DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and CHKov2

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster


Alignment Length:421 Identity:122/421 - (28%)
Similarity:194/421 - (46%) Gaps:60/421 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DASLPTWVEKKELEALVKQIS-EFRKI-----ESLRWKWETQLAEPALCVHIQVLVADNKKRQVS 71
            |...|.||.|:...:|::|.: .|:.|     .|...|.|..|. ..|.:.|::.:.||....||
  Fly     3 DQPTPQWVTKELFSSLLEQSNRNFKAIIKFVPTSAISKGENYLT-IVLRIQIEMQLKDNSIEDVS 66

  Fly    72 YLIKSPETVPVGLKLPRTGDFSTERHMFEVVLPALEELY-QNSDRIVHFGPPVIQAKLKSSHIYG 135
            |::|.| .||...|......|..|..|::.::|.||:|| :|:.....|.|  :..|.....:..
  Fly    67 YILKIP-LVPEDEKNDFHEMFDAELDMYDHLIPELEDLYAKNTSISPKFKP--VHLKFPGEPVKS 128

  Fly   136 DYIL-----NKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAKTPGKIRELPKLRENSKSD 195
            ||||     .|||..|:..:||....:|.||.|||.:||.:|.       ::.||.:..::.:..
  Fly   129 DYILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAK-------RVVELGEYEKDIRES 186

  Fly   196 EETAELKSL-------YQLRFHESLRSNDARQYE---DKVKSFQKYVKSGTEI-----LDSKTSF 245
            ..|.|.:.|       :.:.|.|.:     :||.   .::.....|....|::     .:.....
  Fly   187 YFTTEHQKLLDEFNINFCMPFLECM-----QQYNLEPGQLVLISDYTSQLTDLNIEFGKNDPLEL 246

  Fly   246 NVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDLFSSLLTAP--AEKSSRFDGYVK 308
            :|:.:|..|.||.:.:......|:|..|..|...:||....||...|:|:|  :.|..:||.:::
  Fly   247 SVLNHGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKLDKFDYFIE 311

  Fly   309 FYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGHWAFETATEILPIVL------SDFGN---NDI 364
            :||.||:|:|.:|.:....|:|:.....|.:|..|||..|..:|||||      |..||   |..
  Fly   312 YYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDVDSHIGNVMGNSE 376

  Fly   365 E------ELFRNPVFGEQIRELLPWMENRGY 389
            |      ::|..|.:.:||:.:|||:.||||
  Fly   377 EAIAFKRKMFLLPAYVDQIKVILPWLINRGY 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 79/289 (27%)
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 83/301 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.