DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and CG10560

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_651384.2 Gene:CG10560 / 43065 FlyBaseID:FBgn0039325 Length:414 Species:Drosophila melanogaster


Alignment Length:426 Identity:105/426 - (24%)
Similarity:197/426 - (46%) Gaps:70/426 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QDASLPTWVEKKELEALVK-QISEFRKIESLRWKWETQLAE--PALCVHIQVLVADNKKRQV--S 71
            ::..:|.||:.:..|.|:| .:.:::|.::||.|......|  ..:.:.:::.|....|.:|  :
  Fly    13 REVPIPGWVKPEVFEDLLKDNVKDYKKTKALRAKAGVAAGENYATIMLRLELDVETKDKSEVTKA 77

  Fly    72 YLIKSPETVPVGLK-LPRTGDFSTERHMFEVVLPALEELYQNSDRIVHFGPPVIQAKLKSSHIYG 135
            :::|:|.......| |..|..|..||.|:.||:|.||::|::....|.||....:.|:..:::..
  Fly    78 FMLKTPHDTDAYRKLLQETNIFDVERGMYLVVVPELEQMYRDVGLEVKFGAEAYEIKVSENYVLL 142

  Fly   136 DYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAKTPGKIRELPKLRENSKSDEETAE 200
            :.:..:|:...:.|:||.....|.||.|.|.:||.:|..:                        :
  Fly   143 EDLRPRGFKNVDRLQGLDQAHTESVLRKFAQWHAASAVRV------------------------D 183

  Fly   201 LKSLYQLRFHESL------------RS-----NDARQYEDK---VKSFQ----KYVKSGTEILDS 241
            ||..|:.::....            ||     |:..||:..   :|..|    |......:|.:.
  Fly   184 LKGPYEEKYTNGFFKSKEIMNFFCDRSAKILLNNIDQYDGHAAYIKDLQSVSEKLFDIYNDIKEP 248

  Fly   242 KT-SFNVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDLFSSLLTAPA--EKSSRF 303
            |: .||.:.:|..|.||::.|.:....:.:|.|......::|....||:..||::.:  .|:.:|
  Fly   249 KSDEFNALNHGDGWSNNIMFQYNDKNEISNTYFVDLQLPKWGSVAQDLYYFLLSSTSLDIKTEKF 313

  Fly   304 DGYVKFYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGHWAFETATEILPIVL------SDFG-- 360
            |.:|.|||.:|:::|.||.:..|.|:|..::..|.||..|||..:..::.:||      :||.  
  Fly   314 DYFVWFYHSELVKHLKLLNYSKKLPTLRSIRNALNKYSGWAFICSISVMGVVLLDPTDDADFDKI 378

  Fly   361 -----NNDIEELFRNPVFGEQIRELLPWMENRGYFE 391
                 :|....::.||.:...::.:|||:::||..|
  Fly   379 ISNEHSNFTNSIYTNPRYRRHMKVVLPWLQHRGALE 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 72/296 (24%)
CG10560NP_651384.2 EcKinase 52..333 CDD:281023 73/304 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442569
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.