DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and CG10550

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_651380.2 Gene:CG10550 / 43061 FlyBaseID:FBgn0039321 Length:425 Species:Drosophila melanogaster


Alignment Length:434 Identity:105/434 - (24%)
Similarity:184/434 - (42%) Gaps:83/434 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LPTWVEKKELEALV-KQISEFRKIESLRWKWETQLAEPA---------LCVHIQVLVADNKKRQV 70
            :|.|:.::..:.:: |.:..|.||.:|     ..:|..|         :.|.:.:|:.|..:::|
  Fly    19 IPKWINEEYFQPIIEKDVENFDKIINL-----VPIAATAPGENYTSIMIRVIVDILLKDGSEQRV 78

  Fly    71 SYLIKSPETVPVGLK-LPRTGDFSTERHMFEVVLPALEELYQNSDRIVHFGPPVIQAKLKS---S 131
            ||::|:......|.. :...|.|..||.|:||.:|...:||:.:...:...|..:......   :
  Fly    79 SYILKTMLEADSGADVIDGMGLFPKERKMYEVHIPQFVKLYKEAGLEIELAPKCLHVDATDELIT 143

  Fly   132 HIYGDYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAK------------------- 177
            .::.| :..:.:...:.|||..:..|..||.|||..||  |:.:||                   
  Fly   144 MVFED-LSRQNFKNFDRLKGFDLPHMREVLRKLAELHA--ASVVAKEINGPYDAMYNMSIYNEQS 205

  Fly   178 -----TPGKIRELPKLRENSKSDEETAELKSLYQLRFHESLRSNDARQYEDKVKSFQKYVKSGTE 237
                 :.||.||...|:.....|.|.||              |..||.: |.::.|::.|:....
  Fly   206 RDLFESLGKQREEQFLKAMRNWDLENAE--------------SYIARMW-DPLEVFEEAVQVNQV 255

  Fly   238 ILDSKTSFNVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDLFSSLLTAPAE---K 299
               .:..|||:.:|.||.||::......|.:..|:.......::|....||: .|:|..|.   |
  Fly   256 ---DEDEFNVLNHGDCWSNNIMFNYKDNGEIDRTILVDLQVGKWGSPAQDLW-YLITTSASLDIK 316

  Fly   300 SSRFDGYVKFYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGHWAFETATEI------------- 351
            ...||.:::.||.:|.|.|.||.:....|:|.||.:.:||||.|...||..:             
  Fly   317 IKEFDHFIQIYHQRLAECLKLLNYSKPIPTLRDLHIMMLKYGFWGPLTAMGVMVATLMPTDKDAN 381

  Fly   352 LPIVLSDFGNNDI--EELFRNPVFGEQIRELLPWMENRGYFEED 393
            :.::|:.....|.  ...|.||.:.:.::.|||:.:|:|..:.:
  Fly   382 MKMILAQGPEADAIRYRTFINPYYAKAMKVLLPFFDNKGLLKSN 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 75/297 (25%)
CG10550NP_651380.2 EcKinase 53..340 CDD:281023 75/308 (24%)
APH 108..338 CDD:279908 60/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442571
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.