DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and CG13659

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_651378.1 Gene:CG13659 / 43059 FlyBaseID:FBgn0039319 Length:417 Species:Drosophila melanogaster


Alignment Length:381 Identity:84/381 - (22%)
Similarity:155/381 - (40%) Gaps:80/381 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ADNKKRQVSYLIKSPETVPVGLKLPRTGD---FSTERHMFEVVLPALEELYQNSDRIVHFGPPVI 124
            |.|.....|.:||: ..|..|:|.....|   |:||..|:..|||..|.:.:.::.         
  Fly    65 AQNGNFTKSLIIKT-MIVEEGIKKDMFKDSPLFTTEIGMYTKVLPEWERILRRAND--------- 119

  Fly   125 QAKLKSSHIYG----------DYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAKTP 179
            .|||....||.          |.::..||:|... :.|:...:....||||..||.:..:|.:.|
  Fly   120 PAKLYVECIYHSLQPHQILIFDDLVEMGYAVVRD-RFLTREEISSAYSKLAKIHAISMKFIHEQP 183

  Fly   180 GKIR-------ELPKLRENS----------KSDEETAELKSLYQLRFHE-SLRSNDARQYEDKVK 226
            ..::       |:|.|.::|          :......|| |.||..|.: ||      .::|:::
  Fly   184 EYLKEFKNGLCEMPGLIDSSIISGGMDPFMEMLGRIPEL-SKYQPHFKKISL------HFKDRLR 241

  Fly   227 -SFQKYVKSGTEILDSKTSFNVILNGSCWPNNLLLQVDAFGNVKDT------LFSGFHTAQYGPA 284
             :.|:|..      :.:..:||:.:......|::     |.|.|:|      :...:......|.
  Fly   242 ETMQEYRN------NPQPGYNVLCHADFHSRNMM-----FKNNKETGCFEDCMLLDYQGCNVAPM 295

  Fly   285 VYDLFSS--LLTAPAEKSSRFDGYVKFYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGHWAFET 347
            ..||..|  :|..||::....|..:.:|...|:|.|..:.:.|..|:......::.::.::.|..
  Fly   296 AVDLMYSIYMLMGPAQRREELDILLNYYLSILLETLKKIGYQGSMPTEQGFWAEMKRHRYYEFLL 360

  Fly   348 ATEILPIVLS------DFG----NNDI-EELFRNPVFGEQIRELLPWMENRGYFEE 392
            .:..||:.:.      |.|    |.:. ::|::...|.|:.:.:|...:..|||::
  Fly   361 LSTFLPVSIGLRTHKLDIGDMMHNEETRKKLYQLEDFMEETKSILDRFQKSGYFDD 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 69/299 (23%)
CG13659NP_651378.1 EcKinase 48..336 CDD:281023 69/299 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459836
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.