DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and CG31104

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 / 43054 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster


Alignment Length:440 Identity:80/440 - (18%)
Similarity:169/440 - (38%) Gaps:80/440 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VTQQSQDASLPTWVEKKELEALVKQISEFRKIESLRWKWETQLAEPALCVHIQVLVA---DNKKR 68
            :...:.:...|.|:..:.:..:::   |:.::..|:            ...:||..|   .:...
  Fly     6 IEYNADELQAPAWLNAQFIGDILR---EYEQLPDLK------------VTDLQVSPATAQGDHYA 55

  Fly    69 QVSYLIKSPETVPVG-------LK-LP----RTGDFSTERHMFEV-------VLPALEELYQNSD 114
            .|.:..|...|.|.|       :| :|    ...|..:|.|:||.       .||..|.:.:.:.
  Fly    56 SVMFRTKVEYTTPKGKFFKPLIIKTMPEQEGHKKDMLSESHLFETEIGMYCHALPEFERILREAG 120

  Fly   115 RIVHFGPPVIQAKLKSSH--IYGDYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAK 177
            .......|.|...||...  |:.| ::.:||:|... ...|:..::....|||.:||.:...|.:
  Fly   121 DNTKLFVPCIYHSLKPRQVMIFED-LVPQGYTVIRD-SPPSLGDLKLAFDKLAKWHAVSMKVINE 183

  Fly   178 TPGKIR-------ELPKLREN-------SKSDEETAELKSLYQLRFH-ESLRSNDARQYEDKVKS 227
            .|..::       |:|.:..:       :...|...::..|.:.:.| |.::.|..::.|.::..
  Fly   184 QPYFLKEFQYGLFEMPTIDTDPFITTGMTNFIEMLDKMPELRKYKHHFEKIKDNYMQRLEVEMHE 248

  Fly   228 FQKYVKSGTEILDSKTSFNVILNGSCWPNNLLLQVD-AFGNVKDTLFSGFHTAQYGPAVYDLFSS 291
            :.||.::        ..:.|:.:|.....|::.:.: ..|...|.:...|..:...|...||..|
  Fly   249 YHKYRRN--------DRYYVLCHGDFHLRNMMFRHNKELGAYDDVMLVDFQLSNLCPITVDLTYS 305

  Fly   292 --LLTAPAEKSSRFDGYVKFYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGHWAFETATEILPI 354
              :|..|.::....:..:..|...|:..|..:.:.|..|:..:|...:....::.|...:..|||
  Fly   306 VYMLMEPEQRWEMGENLINEYFSVLVATLRKIGYKGDMPTQRELWEQIQNNKYYDFFLISTFLPI 370

  Fly   355 VLSDFGNNDIE--ELFRNPV----------FGEQIRELLPWMENRGYFEE 392
            ::. ..:||::  |..::..          :.:.:.:||...|..|||::
  Fly   371 MVG-VKSNDLKMHEALQDSQARLKSYFLDDYVQDVYKLLTKYEQLGYFKD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 60/308 (19%)
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 57/298 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459832
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.