DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and CG10514

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster


Alignment Length:440 Identity:95/440 - (21%)
Similarity:166/440 - (37%) Gaps:95/440 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ASLPTWVEKKELEALVKQISEFRKIESLRWKWE------TQL-AEPAL---------CVHIQV-L 61
            |:.|.|:..:.:|            .:||..::      ||| ..|||         ....:| .
  Fly     2 AAAPEWLTHEYIE------------HALRCHYKDEGLTITQLQINPALGPGENYGGVLTRARVEF 54

  Fly    62 VADNKKRQVSYLIKSPE----------TVPVGLKLPRTGDFSTERHMFEVVLPALEELYQ---NS 113
            ...||::.|..||...|          ..|..:       ::.|..:::.|||...||..   ::
  Fly    55 TLSNKEKNVQNLIVKTEIDDDELTQELMAPYDI-------YNREMTIYQEVLPKCRELLNEIGDT 112

  Fly   114 DRIVHFGPPVIQAKLKSSHIYGDYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAKT 178
            :||.   |..|....:...|..:.:...||.:|:.::.|:......:|.|||.:||.||....:.
  Fly   113 ERIF---PTAIYVDRERMAIIFEDLSVVGYVMADRVRRLNEEHTHLILRKLAKFHAATAVLNERQ 174

  Fly   179 PGKIRELPKLRENSKSDEETAELKSLYQLRFHESLRSNDARQYEDKVKSF-----------QKYV 232
            .|.:....:...|        ...:.|...|...|.:  |.::..||.:.           ..|:
  Fly   175 SGCLESYDRGFFN--------RYTNAYSGYFVGGLLA--AARWMSKVPTLAHYGEKLFALAPHYM 229

  Fly   233 KSGTE-ILDSKTSFNVILNGSCWPNNLLLQVDA-FGNVKDTLFSGFHTAQYGPAVYD---LFSSL 292
            ..|.| ...:....||:.:|..|.||::.:.|. .|...|.|...|..:.:|....|   ||::.
  Fly   230 DIGRECFAPTPGQVNVLAHGDVWTNNVMFKYDPNTGRPVDVLLIDFQYSFWGSPCIDLHHLFNTS 294

  Fly   293 LTAPAEKSSRFDGYVKFYHDQLIENLNLLKFLGKK-PSLTDLQLDLLKYGHWAFETATEILPIVL 356
            |..|..:..: :|..:|||....|.|..|.:...: |||...:|::.:...:|..:...:.|:::
  Fly   295 LKEPLRRDQQ-NGLFQFYHKIFTETLEKLNYRQNQIPSLHQFKLEVEQKRFFALHSTVVVQPVMI 358

  Fly   357 SDFGN--------NDIE-------ELFRNPVFGEQIRELLPWMENRGYFE 391
            |....        ||.|       .|:.||...:.:..|:|:.:.:|..|
  Fly   359 SQDPTDACFNALMNDDERGIRFKNRLYNNPTVQQNLHSLVPFFDRKGLLE 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 66/296 (22%)
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 66/305 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459454
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.