DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and CG14314

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:375 Identity:82/375 - (21%)
Similarity:139/375 - (37%) Gaps:71/375 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIESLRWKWETQLAEPALCVHIQVLVADNKKRQVSYLIKSPETVPVGLKLPRTGDFSTERHMFEV 101
            |..||:|:      :..:|   :|:               ||:|...........|..|...:..
  Fly    71 KRRSLKWE------QNVIC---KVM---------------PESVVAREAYKSDKLFRNEVQFYNT 111

  Fly   102 VLPAL---EELYQNSDRIVHFGPPVIQAKLKSSHIYGDYIL-----NKGYSVANGLKGLSVTAME 158
            ::|.|   :....|.|      .||..|..|......|.::     .:|:.:::..||||:...:
  Fly   112 IMPELLKFQASKTNQD------TPVFNAIPKCYSARHDLLIMEDLRERGFQMSDRHKGLSLEETQ 170

  Fly   159 GVLSKLAAYHAGTAAYIAKTPGKIREL-PKLRENSKSDEETAELKSLYQLRFHESLRSNDARQYE 222
            .||.::|..|..:.||..:.|.:...| ..:.|.......|:..::.|     |.|..|..:...
  Fly   171 SVLLQVAQLHGLSLAYKFEKPLEFSNLCSMISEGIFCTANTSWYRNYY-----ERLTKNAIQMVS 230

  Fly   223 DKVKSFQKYVKSGTEILDSKTSF-------------NVILNGSCWPNNLLLQVDAFG--NVKDTL 272
            :.:....|||.:..:..:|.:.|             :.|.:|.||.||.|...|...  .|.:..
  Fly   231 EVLPPDSKYVLAMNKFAESSSFFGRMVKLASTESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVA 295

  Fly   273 FSGFHTAQYGPAVYDLFSSL--LTAPAEKSSRFDGYVKFYHDQLIENL-----NLLKFLGKKPSL 330
            ...|...:|.....|:.:.|  .|....:.::....:|.|.::|...|     ||.........|
  Fly   296 LLDFQLIRYSSIALDIANLLYCCTTKEMRDAQLQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKL 360

  Fly   331 TDLQLDLLK-YGHWAFETATEILPIVLSDFGNNDIEELF--RNPVFGEQI 377
            .||..:.|| ||.:|...|.:||||  |...:.|..:::  |:...||.:
  Fly   361 QDLFAEELKTYGRFALGLALDILPI--STCSSEDAPDMYLDRSDELGEDV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 59/297 (20%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 62/309 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.