DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and CG6834

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster


Alignment Length:423 Identity:115/423 - (27%)
Similarity:199/423 - (47%) Gaps:62/423 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PTWVEKKELEALV-KQISEFRKIESLRWKWETQLAEPALC-----------VHIQVLVADNKKRQ 69
            |.|:.:.:.|.|: ..:.:|.||...:.|       ||:.           :.|.|.:.|...:.
  Fly    62 PEWLNQTQFEELLAAHVDQFSKIVGFQVK-------PAMAPGENYATLMLRISIDVELTDKSTKL 119

  Fly    70 VSYLIKSPETVP-VGLKLPRTGDFSTERHMFEVVLPALEELYQNSDRIVHFGP------PVIQAK 127
            |.:::|.|..|| :...|.....|::|..::..:||.|||||:.....:.|.|      .|.:.|
  Fly   120 VCFMLKVPHNVPQMEQMLAMANFFNSENKVYSDILPKLEELYKAKGLDITFAPKAFKLDSVKEPK 184

  Fly   128 LKSSHIYGDYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTA-----------AYIAKTPGK 181
            |.::.:..| :...|:...|.|:.|::...:..|.|||.:||.::           .::....|.
  Fly   185 LANTVLMSD-LSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVNGPYEDQFVNGVMGG 248

  Fly   182 IRE-LPKLRENSKSDEETAELKSLYQLRFHESLRSNDARQYEDKVKSFQKYVKSGTEILDSKTSF 245
            .:| |....|...:...||.:.:|...:..|..|....:.:......|:..:.:..:      .|
  Fly   249 NKEVLMAFYEGMVASFRTALMANLKNFKNGEEFREKLEKAFVQIFLDFEHLMTADPD------EF 307

  Fly   246 NVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDLFSSLLTAP--AEKSSRFDGYVK 308
            ||:.:|.||.||||.::|:.|.|:|.||..|...:||....|||..:||:.  ..|...|:.:::
  Fly   308 NVLNHGDCWMNNLLFKLDSKGEVQDMLFVDFQNPKYGSPTQDLFYLILTSVHIDYKLDYFEYFIR 372

  Fly   309 FYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGHWAFETATEILPIVLSD----------FGNND 363
            .||:||.::|:||.|.||:|||.:|.:.:.|:|.||...:..:|||||.|          .|:::
  Fly   373 HYHEQLTQHLDLLGFTGKQPSLRELHMLMYKHGSWAVFPSIGVLPIVLLDPNESATFENFLGDSE 437

  Fly   364 IEELFRNPVFGEQ-----IRELLPWMENRGYFE 391
            ....|:|.::..:     |.:||||::|:|:.|
  Fly   438 SSAKFKNLLYTNKRYHGYIEKLLPWLDNKGFLE 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 77/287 (27%)
CG6834NP_650104.2 EcKinase 95..387 CDD:281023 77/298 (26%)
EcKinase 529..813 CDD:281023
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442568
Domainoid 1 1.000 53 1.000 Domainoid score I7597
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.