DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and CG11889

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001287526.1 Gene:CG11889 / 3772506 FlyBaseID:FBgn0039308 Length:417 Species:Drosophila melanogaster


Alignment Length:428 Identity:94/428 - (21%)
Similarity:177/428 - (41%) Gaps:73/428 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PTWVEKKELEALVKQISEFRKIESLRWKWETQLAEPALC-----------VHIQVLVADNKKRQ- 69
            |.|:.::.:|   |::..:.|.::|..|..|  .:||..           :.::.:..|:|..| 
  Fly    10 PAWLTEEYVE---KKLRVYFKNDTLNLKKLT--IKPATANGENYASVMTRISVEYITKDSKDNQS 69

  Fly    70 VSYLIKS--PETVPVGLKLPRTGDFSTERHMFEVVLPALEELYQNS--DRIVHFGPPVIQAKLKS 130
            .::|:|:  .:..|....|...|.::.|..|:|.:||.|.::.:|.  |....|...|...:.:.
  Fly    70 ATFLLKTTFADKDPAAHLLINYGIYTREIDMYEQILPRLADIVKNELHDSRKLFAATVGVDRERD 134

  Fly   131 SHIYGDYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAKTPG-------------KI 182
            |.::.|..|.: |.||..:|.|.:.....||.|||.:||..||...:.||             .:
  Fly   135 SIMFEDLSLER-YKVACRVKKLDLEHTYLVLEKLADFHAAGAALAQRQPGIFEKNYDRGFFNKHV 198

  Fly   183 RELPKLREN-----SKSDEETAELKSLYQLRFHESLRSNDARQYEDKVKSFQKYVKSGTEILDSK 242
            |....:.:|     |::.:.:.:||..||.:.            :..:.:...|.:..|.:  :.
  Fly   199 RGYEPIMKNILKALSRTLDLSPDLKERYQAKI------------DRLIDNVMDYGERSTSV--AP 249

  Fly   243 TSFNVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDLFSSLLTAPAE--KSSRFDG 305
            ..|..:.:|..|..|::.|.|..|:..:.:|..|..:.:.....||.....|:..|  :..|...
  Fly   250 GDFVTLAHGDIWTTNVMFQYDDEGHPVNAIFIDFQFSVWNSPAIDLQYFFSTSIHENLRLERQTE 314

  Fly   306 YVKFYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGHWAFETATEILPIVLSDFGNND--IEELF 368
            .|:||..:|:..|..:|:.||.|||.:.|......|.:|...:....|.::.: |..:  ||:..
  Fly   315 LVQFYFYKLVVALERVKYSGKVPSLFEFQQQFRTKGFYAVFASLIFEPTMVYN-GKEEPSIEQFM 378

  Fly   369 RNPVFGEQIRE--------------LLPWMENRGYFEE 392
            .:...|.::|:              .||:::..|..:|
  Fly   379 TSDEKGVRLRDAVYQTEENLKKLHLTLPFLDQLGLLDE 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 65/291 (22%)
CG11889NP_001287526.1 EcKinase 44..332 CDD:281023 65/302 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.