DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and CG11891

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001027211.3 Gene:CG11891 / 3772439 FlyBaseID:FBgn0039309 Length:417 Species:Drosophila melanogaster


Alignment Length:423 Identity:94/423 - (22%)
Similarity:172/423 - (40%) Gaps:66/423 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LPTWVEKKELEALVKQISEFRKIESLRW-KWETQLA--------EPALCVHIQVLVADNKKRQVS 71
            :|.|:.:..:|..::  |.||. :|||. ..:.:||        .....::::.....:|.:|.:
  Fly    12 VPAWLTRDYVEQKLR--SYFRN-DSLRLVNLDIKLALGNGENYSSVITRIYVEYTTDKSKDKQST 73

  Fly    72 YLIKSPETVPVGLKLPRTGDFSTERHMFEVVLPALEELYQN--SDRIVHFGPPVIQAKLKSSHIY 134
            ...:..:..|....|...|.::.|..::|.:||.:.|:.:|  :|....|...|...:.:.|.|:
  Fly    74 RFTRFADAGPAAQVLLSYGVYNRELDLYERILPQMAEVVRNELADSRKLFAGTVYVDRKRDSIIF 138

  Fly   135 GDYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAKTPG-------------KIRELP 186
            .|..| :.|.||:.||.|.:.....||.|||.:||..||...:.||             ..|...
  Fly   139 EDMSL-ENYRVADRLKKLDLEHTHLVLEKLANFHAAGAALAERQPGIFAKNFDRGFFNQHTRGYE 202

  Fly   187 KLREN-----SKSDEETAELKSLYQLRFHESLRSNDARQYEDKVKSFQKYVKSGTEILDSKTSFN 246
            .:.:|     |:|.|...:|...||.:.            :..|::..:|.:..|.|:..  .|.
  Fly   203 PIMKNLLMALSRSLELEPDLCQRYQAKI------------DRLVENVMEYGERSTTIVPG--DFL 253

  Fly   247 VILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDL---FSSLLTAPAEKSSRFDGYVK 308
            .:.:|..|..|::.|.|..|:..:.:|..|..:.:.....||   ||:.|.|......:.: .|:
  Fly   254 TLAHGDLWTTNIMFQYDDKGHPINAIFIDFQFSAWNSPAIDLHYFFSTALQADIRLKKQPE-LVQ 317

  Fly   309 FYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGHWAF---------------ETATEILPIVLSD 358
            ||:.:|...|..:::.|..|||............:|.               |.|:....|.||:
  Fly   318 FYYYKLNAALKKVQYSGNVPSLFVFHQQFRNRSFYAAFASLIFEPTMTYTGKEEASMDQIISLSE 382

  Fly   359 FGNNDIEELFRNPVFGEQIRELLPWMENRGYFE 391
            .|....::.|:.....:::|..||::::.|..:
  Fly   383 KGMRFKDDAFQAEETRKKMRLTLPFLDHLGLLD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 67/289 (23%)
CG11891NP_001027211.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.