DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and CG16898

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster


Alignment Length:442 Identity:92/442 - (20%)
Similarity:158/442 - (35%) Gaps:110/442 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LPTWVEKKELEALVKQISEFRKIESLR----WKWETQLAEPA-----------LCVHIQVLVADN 65
            ||.|:.:   |.|..::..:.|.:.|:    |      |:||           ..:|:::...|.
  Fly     2 LPNWLTE---EYLQPKLRAYYKDDQLKVVKVW------AKPATEKGQNYMSLMTRIHVEIQQGDG 57

  Fly    66 KKRQVSYLIKS--PETVPVGLKLPRTGDFSTERHMFEVVLPALEELYQNSDRIVHFGPPVIQAKL 128
            ..:..:|:||.  .|..|..........::.|..|:|.:||.:.||.|.......|....|....
  Fly    58 LLQNRTYIIKESLSEDCPQAKVFLEYDVYNREMDMYEFILPKMNELLQEVGLTGKFTADTIFVDR 122

  Fly   129 KSSHIYGDYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAKTPGKIRELPKL----- 188
            :...|..:.:....|..|:.:|.|.:...:..|..||.:||  |:.:.|     :..|:|     
  Fly   123 EYRTIILEDLAQYNYVNADRVKQLDLAHTKLTLEVLAKFHA--ASIVVK-----QRHPELLTKSL 180

  Fly   189 ------RENSKSDE--------------ETAELKSLY---QLRFHESLRSNDARQYEDKVKSFQK 230
                  |:|....|              |...||..|   ..:.||::....||.:|        
  Fly   181 FIHCFSRDNKGYTEVYEGVLSAFIRFINEQPVLKKKYGNKLQKIHENIMDYGARTFE-------- 237

  Fly   231 YVKSGTEILDSKTSFNVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDLFSSLLTA 295
              ....|:|       .:.:|.||..|.|.|.|...|.:..:...|..:.:...|.||......:
  Fly   238 --VGEQELL-------TLSHGDCWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTVS 293

  Fly   296 PAEKSSRFDG-YVKFYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGHWAFET-------ATEIL 352
            ..::....:. .|:.|:..|..|::.|.:.|..|||...|..        ||:       |....
  Fly   294 LRDEVQDMESVLVEKYYSDLKTNVDTLSYKGIFPSLQGFQKQ--------FESRRFMCLLAHLFK 350

  Fly   353 PIVL-------SDFGN--NDIEE--LFRNPVFGEQ-----IRELLPWMENRG 388
            |:::       |||.:  .|.||  .|:..::..:     ..:||..::.:|
  Fly   351 PVIIYDGTEVSSDFSSVYKDTEEGIRFQKAIYANERVLKSATKLLAMLDAKG 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 62/297 (21%)
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 62/308 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459406
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.