DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and F59B1.10

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_872223.1 Gene:F59B1.10 / 353438 WormBaseID:WBGene00019101 Length:428 Species:Caenorhabditis elegans


Alignment Length:385 Identity:75/385 - (19%)
Similarity:145/385 - (37%) Gaps:89/385 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VHIQVLVADNKKRQVSYLIKSPETVPVGLKLPRTGDFSTERHMFEVVLPALEELYQ--------- 111
            ||||.|:...|::..|.:.|                 ..|..|:.....:.::::.         
 Worm    84 VHIQALIDKGKQQNASLITK-----------------EVEEQMYAYFESSCKKMHNQEMNFYEVA 131

  Fly   112 ---NSDRI----VHFGPPVIQAKLKSSHIYGDYILNKGYSVANGLKGLSVTAMEGVL---SKLAA 166
               ||..:    |:|...:.:.......|..:|:  :|..|.:.....::..::.:|   :||.|
 Worm   132 GKFNSKTLLIPKVYFYTKLDEKNSNKGFIGMEYV--EGSIVRHSYDTCTIEEIQPILRAIAKLQA 194

  Fly   167 YHAGTAAYIAKTPGKIRELPKLRENSKSDEETAELKSLYQLRFHESLRSNDARQYEDKVKSFQKY 231
            ......|.|:|...||......:|..|.....:.:|.::     |..|:.:..::.:||...:  
 Worm   195 LSLQNPAEISKDLQKIDNGAIFQETLKMMLSESGIKGIF-----EQCRNLERSRFGEKVDRIE-- 252

  Fly   232 VKSGTEILDSKTSF----------NVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVY 286
             :...||||.:.:|          ||:.:|..|..| .|..:..|....|....:..:..|....
 Worm   253 -EKRNEILDFEKAFNLNKVVGIKQNVLCHGDLWAAN-FLWTENNGVFCATRIVDYQMSHLGNPAE 315

  Fly   287 DLFSSLLT--APAEKSSRFDGYVKFYHDQLIENLNLLKFLGKKP-SLTDLQLDLLKYGHWAFET- 347
            ||...|::  ..|::.:.:...::.::...:..|.    .|:.| :|..|:|....|    |.. 
 Worm   316 DLVRLLVSTITGADRQAHWQQILEQFYSYFLNELG----SGEAPYTLEQLKLSFKLY----FPVG 372

  Fly   348 ATEILPIVLSDFG----------NNDIEELFRNPVFGEQIRELLPWME-----NRGYFEE 392
            |..:||:    ||          :::..|..|:.|. |::..||..:|     ::.||:|
 Worm   373 ALALLPL----FGPAVDAKLEGMDSEKAEKCRHVVI-EKVACLLDDLEKYHKFSKRYFQE 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 53/297 (18%)
F59B1.10NP_872223.1 DUF1679 8..422 CDD:369592 72/378 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.