DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and CG9497

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001260130.1 Gene:CG9497 / 33884 FlyBaseID:FBgn0031800 Length:417 Species:Drosophila melanogaster


Alignment Length:386 Identity:83/386 - (21%)
Similarity:148/386 - (38%) Gaps:93/386 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 DNKKRQVSYLIKS-P--------ETVPVGLKLPRTGDFSTERHMFEVVLPALEELYQNSDRIVHF 119
            |:.::.:::::|| |        :.:.|.||         |:..:..|||.||.|.|.:.|   |
  Fly    67 DHPEQHMAFIVKSIPHLDSVEFIDDLQVYLK---------EKITYYEVLPRLELLMQCNRR---F 119

  Fly   120 GPPVIQ--AKLKSSHIYGDYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAY-------- 174
            ||.:..  .:.::|.::.| :..||:.:|:...||:....:.|:.:||.:||.:.|.        
  Fly   120 GPKLYHYLKQPENSLVFED-LAEKGFVMASRELGLNEEHCQLVMERLAEFHATSMALAVVDPHIF 183

  Fly   175 ------------IAKTPGKI--------RELPKLRENSKSDEETAELKSLYQLRFHESLRSNDAR 219
                        :||..|.:        :||..|.......|:.||....|......:|..:.|.
  Fly   184 DAYGDGMLSPRGLAKDDGLLMQFFSGNGKELHHLVSTWPGFEKIAEKIGKYMQNQRANLERSQAP 248

  Fly   220 QYEDKVKSFQKYVKSGTEILDSKTSFNVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPA 284
            |        :|.||             |:.:|..|.||:|.:.|.....:|.:...|..:.:|..
  Fly   249 Q--------EKEVK-------------VLNHGDLWVNNMLFKYDGAQRPQDLILIDFQLSVWGSP 292

  Fly   285 VYDL---FSSLLTAPAEKSSRFDGYVKFYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGHWAFE 346
            ..||   |.:.||....:..|.. .::.||.:|.:.|..|......||...:..::.:...:.|.
  Fly   293 GIDLNYFFYTSLTLEVLRHRRTQ-LLRTYHARLAKTLLDLDMGIPVPSYEQILEEVHRRESYGFF 356

  Fly   347 TATEILPIVL----------------SDFGNNDIEELFRNPVFGEQIRELLPWMENRGYFE 391
            .:..|.|.|.                :||....:.::|::....:.:|..||..|..|..:
  Fly   357 ASYGIFPTVSQDKAQTADNNLENFKDADFAKQKVRQMFQSRRLADTLRYTLPHFERAGVLD 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 69/300 (23%)
CG9497NP_001260130.1 EcKinase 49..331 CDD:281023 68/298 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459272
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.