DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and CG33511

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:391 Identity:87/391 - (22%)
Similarity:156/391 - (39%) Gaps:81/391 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VHIQVLV-ADNKKRQVSYLIKS--PETVPVGLKLPRTGDFSTERHMFEVVLPALEE--------- 108
            :|::..| .|.||..::|.|||  .:..|...:..|.|.|..|..::..:||.:::         
  Fly    49 LHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERKGVFQKESALYSQILPKIQKYATKKLYPK 113

  Fly   109 -LYQNSDRIVHFGPPVIQAKLKSSHIYG-DYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGT 171
             .|..:|.:|..........|:::..|. |:     |.:              ||..|:..||.:
  Fly   114 CYYSRNDILVLEDLTQDYRHLRANEYYTLDH-----YKI--------------VLEHLSELHAAS 159

  Fly   172 AAYIAKTPGKIRE-----LPKLRENSKSDEETAELKSLYQLRF-HESLRSNDARQY-EDKVKSFQ 229
            .|:..|...||.|     |.:|..:|.:......||::..|.. :...::..|:.: :||:  :.
  Fly   160 IAWEEKENVKIYESYKNVLIELHLDSNNSWYITGLKAIVFLAARNPHFQTMKAQNFIQDKL--YN 222

  Fly   230 KYVKSGTEILDSKTSFNVILNGSCWPNNLLLQVDAFGNV--KDTLFSGFHTAQY-GPAVYDLFSS 291
            ...|:...:..|||..||:.:...|.:|::...:...:|  .......|...|| .|.:..||..
  Fly   223 LLTKAEELVAPSKTIRNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLL 287

  Fly   292 LLTAPAE-KSSRFDGYVKFYHDQL---IENLNLLKFL------GKKPSLTDLQLDLLKYGHWAF- 345
            .:.|.|| :.:.:|..::.|:..|   ::.|.|.|.|      .|:...|.|...::    ||. 
  Fly   288 YIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNLITENNFRKECQRTRLAALVI----WALT 348

  Fly   346 ETATEILPIVLSDFGNNDIEE------------LFR----NPVFGE----QIRELLPW-MENRGY 389
            |..|::.|.:.:...:.:.|:            |.|    .|.:.|    .||||:.: |||...
  Fly   349 EPQTKMSPSISNRLRSEEPEKFDYYLNCDRSELLLRVIEIQPGYEETIMTPIRELVDYLMENENL 413

  Fly   390 F 390
            :
  Fly   414 Y 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 65/294 (22%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 63/290 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459724
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.