DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and CG1561

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster


Alignment Length:407 Identity:98/407 - (24%)
Similarity:156/407 - (38%) Gaps:81/407 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSPLLVTQQSQ----DASLPTWVEKKELEALVKQI-SEFRKIESLRWKWETQLAEPALCVHIQV 60
            |.||  |.||..    |..||.....:.|..||.|: .|......||.:..:...:..|.|..::
  Fly   206 MESP--VEQQEDTAKPDEDLPNEQVTQFLRQLVSQLWPELGANPELRLERASAKGDNYLGVVWRL 268

  Fly    61 LVADNKKRQVSYLIKSPETVPVGLK--LPRTGDFSTERHMFEVVLPALEELYQNSDRIV------ 117
            ..|.:.||  |.::|.|....|..|  ..|. .|..|...:||.|| |..|.|:..:|:      
  Fly   269 QAASDSKR--SLVVKLPPQNRVRRKQFFARP-CFLRETAAYEVFLP-LTALIQDKWKIIGDDRFR 329

  Fly   118 -H---FGPPVIQAKLKSSHIYGDYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAKT 178
             |   ||  ..|.:.....:..| :...|:|:.|....|||..:..|:...|..||.:.|...:.
  Fly   330 QHALCFG--TRQDEPNECIVLED-LSCAGFSLHNRFLDLSVEHVRRVMLTYAKLHAISLAGKRQL 391

  Fly   179 PGKIRELPKLRE--NSKSDEETAELKSLYQLRFHESLRSNDARQYEDKVK-SFQKYVKSGT--EI 238
            |.|:::|.:|.:  ..:.|:...   .:|.....||..|......:|..: ..:.|...|:  |:
  Fly   392 PEKMQQLQQLVDIFEQRRDDHAL---GVYFENLKESALSALLAPADDAYRVRLEAYFARGSYFEL 453

  Fly   239 LDSKTS------FNVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDLFSSLLTAPA 297
            |....|      |.||.:|.||.||:|.:....|.::|.....:...:|...|.||...|.|..:
  Fly   454 LLPLVSGFNCEPFAVICHGDCWNNNILYKSTERGELEDVRLIDWQLMRYASPVTDLAYFLFTCTS 518

  Fly   298 E--KSSRFDGYVKFYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGHWAFETATEILPIVLSDFG 360
            .  :....:..::.|:::|  .|.|:: ||::                                 
  Fly   519 RRFRQRHLENMLEDYYEEL--GLQLIR-LGER--------------------------------- 547

  Fly   361 NNDIEELFRNPVFGEQI 377
               :|:||..|.|.||:
  Fly   548 ---VEQLFPRPAFDEQV 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 72/291 (25%)
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 74/301 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459869
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.