DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and CG31975

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster


Alignment Length:362 Identity:72/362 - (19%)
Similarity:146/362 - (40%) Gaps:73/362 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LCVHIQVLVADNKKRQVSYLIKSPETVPVGLKLPRTGDF-------STERHMFEVVLPAL----- 106
            |.:|.::..::.:..:...:.|.|   |:.   |:...|       .||..:::::.|||     
  Fly    45 LAIHARLQKSNGESFEEQLVAKVP---PID---PKYWQFFQPEQTCLTENAVYKILAPALATLQD 103

  Fly   107 --------------------EELYQNSDRIVHFGPPVIQAKLKSSHIYGDYILNKGYSVANGLKG 151
                                |.|..||.::......|::....|.::.|..:  |.:.:|:.|..
  Fly   104 EAGVPDESQFKGFPRFYGCRESLESNSSKVDQNAVLVLENLRSSGYVSGQRL--KAFDLAHTLLA 166

  Fly   152 LSVTAMEGVLSKLAAYHAGTAAYIAKTPGKIRELPKLRENSKSDE---ETAELKSLYQLRFHESL 213
            |..         :|.:||.:.|.....|...||  ::|...|..:   |..|.||:.:....|.:
  Fly   167 LKY---------MAEFHALSLALRILRPEVFRE--QVRPFFKKFDWHAEAPEWKSVMKAETLEDI 220

  Fly   214 R---SNDAR---QYEDKVKSFQKYVKSGTEILDSKTSFNVILNGSCWPNNLLLQVDAFGNVKDTL 272
            |   :||:|   :.::....|.:::.:..:..|.  .|..|::...|.||::.:....|...:..
  Fly   221 RRATNNDSRLVARMKELSDQFFEFLAAAPDRPDG--PFTSIIHCDFWINNIMFRYGPTGTPVELK 283

  Fly   273 FSGFHTAQYGPAVYDLFSSLLTA--PAEKSSRFDGYVKFYHDQLIENLNLLKFLGKK---PSLTD 332
            ...|.||||...|:|:.|.||::  .|.....|:..::.|::..   ...|:.:|.|   .:..:
  Fly   284 IIDFQTAQYDSVVHDIISFLLSSVDTAILEVEFEHMLEAYYEAF---ERCLRRVGAKLEVHTFKE 345

  Fly   333 LQLDLLKYGHWAFETATEILPIVLSD---FGNNDIEE 366
            .:|::.:..:.....|..:...:|:|   .|:::.||
  Fly   346 FRLEVKRVAYIQVPHAIFMTRFILADSALIGDSEAEE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 62/309 (20%)
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 63/313 (20%)
APH <214..329 CDD:279908 26/119 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459619
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.