DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and CG31380

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster


Alignment Length:430 Identity:97/430 - (22%)
Similarity:171/430 - (39%) Gaps:86/430 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LPTWVEKKELEALVKQISEFRKIESLRWKWETQLAEPAL-----------CVHIQVLVADNKKRQ 69
            :..|:..:.|||.::     |..::...:.|:.:..|||           .:|: |..:..::..
  Fly     1 MAAWLTAEYLEAALR-----RYYQNNELRVESMVINPALGKGENYGAILTRIHL-VYSSIVEEHL 59

  Fly    70 VSYLIKSPETVPVGLKLPRTGDFSTERHMFEVVLPALEEL--YQNSDRIVHFGPPVIQAKLKSSH 132
            ::..:...|.....:|......::.|..::|.|||.|:||  .|...:|:|..      :.:.:.
  Fly    60 IAKTVLEYEDAETKMKKAPYDIYNRELEIYEQVLPKLQELAGEQLCPKILHID------RQRGAL 118

  Fly   133 IYGDYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAKTPGKIRELPKLRENSKSDEE 197
            |..| :..||:.:|..|:.|....:..||.|||...|.:|         :.| ..|.||:.|..|
  Fly   119 IMED-LSYKGFVMAPRLQRLDEQHVSLVLRKLAKMQAASA---------VLE-NNLLENNFSLTE 172

  Fly   198 TAELKSLYQLRFHESLRSNDARQYEDKVKSFQKYVK--SGTE----ILD---------------- 240
                   |...|......:.:..:...:||...|:|  :|.|    :||                
  Fly   173 -------YDKGFFNRYTESFSAYFLGCLKSCANYLKTQAGYEHHAKLLDELAPYYMGLGLRCFKQ 230

  Fly   241 SKTSFNVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDLFSSLLTAPAEKSSRFDG 305
            .:|..||:.:|..|.||::.:.:| |...|.|...|..|.:|....|: ..||...|.:..|.:.
  Fly   231 EQTHINVLTHGDLWTNNMMFKYEA-GVPSDVLLIDFQYAFWGSPTLDI-HHLLNTSAVEQVRSEL 293

  Fly   306 YVKF---YHDQLIENLNLLKFLGKK-PSLTDLQLDLLKYGHWAFETATEILPIVL------SDF- 359
            .:|.   |||..:..|..|.|.|:: ||.....|:..:...:|......:||::|      :|| 
  Fly   294 QMKMRGVYHDVFVGELQRLGFKGQRLPSRKQFHLESEQKRFYAVHCGLLLLPVLLNTDETDADFA 358

  Fly   360 --------GNNDIEELFRNPVFGEQIRELLPWMENRGYFE 391
                    |.:....|:.||...:.|::::...|..|..:
  Fly   359 ALLSDQPRGMDMKRRLYLNPGIQDSIKQMVKHFELEGLLD 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 70/293 (24%)
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 70/304 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459438
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.