DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and CG31288

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_733094.1 Gene:CG31288 / 318664 FlyBaseID:FBgn0051288 Length:428 Species:Drosophila melanogaster


Alignment Length:448 Identity:105/448 - (23%)
Similarity:175/448 - (39%) Gaps:91/448 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VTQQSQDASLPTWVEKKELEA-LVKQISEFRKIESLRWKWETQLAEP--------ALCVHIQVLV 62
            :...::...:|.|:.:|..|: |.|...:..|:    .|:....|.|        .|.|:|::.:
  Fly     7 IVNPNEHLIIPDWINEKYFESVLAKDEPDHVKV----LKFTVVAAIPPGENFTSTMLRVYIKLEM 67

  Fly    63 ADNKKRQVSYLIKS--PETVPVGLKLPRTGDFSTERHMFEVVLPALEELYQNSDRIVHFGPPVIQ 125
            .|...:..:|:.|:  ||. ..|..:...|.|..|..|::..|||.|.||::....:...|..:.
  Fly    68 KDGSVKTKTYIFKTMLPEE-RGGSDINEFGLFPKEAMMYKTYLPAFEALYKDVGWDIQLAPKCLH 131

  Fly   126 AKLKSS--HIYGDYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAKTPGKIRELPKL 188
            .:.:..  |...:.:..|.:...:..|||.:..|...|.|||.|||.:|.|              
  Fly   132 TEEREGDIHFIFEDLCVKRFKNMDRTKGLDMEHMTKCLQKLAEYHAASAVY-------------- 182

  Fly   189 RENSKSDEETAELKSLYQLRFHESLRSNDAR-------QYEDK----------VKSFQKYVKSGT 236
                      .||...|...|.|.....|.:       |.::|          :|...||:|:..
  Fly   183 ----------EELHGPYPSEFSEGFVKKDVKKFHVDGFQLKEKAYKKAMLSWGLKDADKYIKAFP 237

  Fly   237 EILD-----------SKTSFNVILNGSCWPNNLLLQVDAFGNVKDTLFSGFHTAQYGPAVYDLFS 290
            .:..           :...|:|:.:|..|.:||:......|.::..:...|....:|....||..
  Fly   238 TVKQYWAQCLSTLELNPDEFHVLNHGDFWSSNLMSSYLPDGTLEKLILIDFQIVMWGSPAMDLLF 302

  Fly   291 SLLTAPAE--KSSRFDGYVKFYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYGH--WAFETATEI 351
            .|..:|..  :...||.:|:.|.::|:|.|.:||.....|.|.|||..:....|  :||.:....
  Fly   303 FLTLSPTNDLRIKEFDHFVRIYWERLVECLKVLKLKKPLPKLRDLQNSMNNKNHSFYAFFSILNH 367

  Fly   352 LPIVL---------------SDFGNNDIEELFRNPVFGEQIRELLPWMENRGY--FEE 392
            |||:|               ::.|.|....|..||.||..:::|.|::.|||.  ||:
  Fly   368 LPIILFPTDKDSNIHNLSANTEEGENYRLRLLSNPAFGNVMKDLYPFLYNRGILNFED 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 67/300 (22%)
CG31288NP_733094.1 EcKinase 50..331 CDD:281023 65/305 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442570
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.