DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and E02C12.9

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001343650.1 Gene:E02C12.9 / 183988 WormBaseID:WBGene00017094 Length:352 Species:Caenorhabditis elegans


Alignment Length:249 Identity:49/249 - (19%)
Similarity:98/249 - (39%) Gaps:30/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 LKSSHIYGDYILNKGYSVANGLKGLSV-TAMEGVLSKLAAYHAGTAAYIAKTPGKIRELPKLREN 191
            :.::|..|.|:......:...::|:|. :|:...||......||.:.::.:...::.....|:::
 Worm    96 VSNAHDVGMYLSIPADELIPLVRGISTFSALGEKLSDNEKKFAGGSDFLERMFSQLFNSSSLQKH 160

  Fly   192 SKSDEETAELKSLYQLRFHESLRSNDARQYEDKVKSF---QKYVKSGTEILDSKTSFNVILNGSC 253
            .:......|.:..||:              :..:::|   ||.:|..|:|.:.....:|:.:|..
 Worm   161 FQGMYSVFEKEKYYQV--------------DGLIETFVVYQKLLKKYTKISELLGFKSVLNHGDL 211

  Fly   254 WPNNLLLQVDAFGNVK-DTLFSGFHTAQYGPAV--YDLFSSLLTAPAEKSSRFDGYVKFYHDQLI 315
            |.:|::..::..|.:| :.:.....|....|.:  .:|....|:|...:....| .:..||...|
 Worm   212 WQSNMIHSMENNGKLKLEAIIDWQSTVILPPGLDTAELIVGCLSAEDRREKGHD-LLLLYHKTFI 275

  Fly   316 ENLNLLKFLGKKPSLTDLQLDLLKYGHWAFETATEILPIVLSDFGNNDIEELFR 369
            .......|     |..:||.....|...|   |..|:|.::|...|..|.|..|
 Worm   276 NVFGSEVF-----SFEELQDSYNLYFPMA---AILIVPGMISFMTNTQITEAER 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 35/201 (17%)
E02C12.9NP_001343650.1 PKc_like 3..343 CDD:389743 49/249 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I4140
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.