DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18765 and C29F7.1

DIOPT Version :9

Sequence 1:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:377 Identity:75/377 - (19%)
Similarity:114/377 - (30%) Gaps:142/377 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ISEFRKIESLRWKWETQLAEPALCVHIQVLVA--------------DNKKRQVSYLIK------- 75
            :|..||:: |.:..|.:|..|.|..::.:.:|              |..|...:.:::       
 Worm    44 MSMIRKVQ-LHFDAEQELKHPNLPKNVVIKIASCAKLGEGVGSVGVDVNKGNAAAIMELFMHNTE 107

  Fly    76 ------------SPETVPVGLKLPRTGDFSTERHMFEVVLPALE--------------ELYQNSD 114
                        .|..|||.....:.||  .|..:..:|:...|              :|::..|
 Worm   108 CNYYNVFRKYTDLPMKVPVIYCAAKAGD--AEAPVPVIVMEMFEDCTVHDLIDGFDKDQLFKIVD 170

  Fly   115 RIVHFGPPVIQAKLKSSHIYGDYILNKGYSVANGLKGLSVTAMEGVLSKLAAYHAGTAAYIAKTP 179
            .||:.            ||: .....:..||      |..:||...:....|.....|..:||:|
 Worm   171 EIVNL------------HIF-SLTTEEWRSV------LPDSAMRDTVDLFEAMVKTIAENMAKSP 216

  Fly   180 GKIRELPKLRENSKSDEETAELKSLYQLRFHESLRSNDARQYEDKVKSFQKYVKSGTEILDSKTS 244
            |       |...||..|:|.                       ||..||.  .|...|.|:.|..
 Worm   217 G-------LEIISKYIEKTF-----------------------DKDPSFM--TKFSDEYLEGKRK 249

  Fly   245 FNVILNGSCWPNNLLLQVDAFGNVKDTLFSG---FHTAQYGPAVYDLFSSLLTAPAEKSSRFDGY 306
             :|:.:|..|...:|..       ||...:|   :.....|..:.||...|.|..:         
 Worm   250 -SVLTHGDLWSPQILWD-------KDDNIAGIIDWQVGHQGSPMEDLHRILSTGTS--------- 297

  Fly   307 VKFYHDQLIENLNLLKFLGKKPSLTDLQLDLLKYG--------HWAFETATE 350
                    :||.|.|    .|| |.|...:.|..|        .|..|...|
 Worm   298 --------VENRNKL----TKP-LLDHYFEKLSAGLEEKGVKMPWTREEVDE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 58/316 (18%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 54/260 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.